PDB entry 1tfg

View 1tfg on RCSB PDB site
Description: an unusual feature revealed by the crystal structure at 2.2 angstroms resolution of human transforming growth factor-beta2
Class: growth factor
Keywords: growth factor
Deposited on 1992-11-17, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transforming growth factor, beta 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61812 (0-111)
  Domains in SCOPe 2.05: d1tfga_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tfgA (A:)
  aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
  vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs