PDB entry 1t7j

View 1t7j on RCSB PDB site
Description: crystal structure of inhibitor amprenavir in complex with a multi-drug resistant variant of HIV-1 protease (L63P/V82T/I84V)
Class: hydrolase
Keywords: hiv-1 protease, drug resitance, thermodynamics, substrate envelope, hydrolase
Deposited on 2004-05-10, released 2005-05-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (0-98)
      • engineered (6)
      • engineered (13)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1t7ja_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35963 (0-98)
      • engineered (6)
      • engineered (13)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1t7jb_
  • Heterogens: ACT, 478, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t7jA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t7jB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptptnvigrnlltqigctlnf