PDB entry 1spw

View 1spw on RCSB PDB site
Description: Solution Structure of a Loop Truncated Mutant from D. gigas Rubredoxin, NMR
Class: electron transport
Keywords: Truncated loop, ELECTRON TRANSPORT
Deposited on 2004-03-17, released 2005-03-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Desulfovibrio gigas [TaxId:879]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00270 (16-38)
  Domains in SCOPe 2.05: d1spwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1spwA (A:)
  mdiyvctvcgyeydpafedlpddwacpvcgaskdafekq