PDB entry 1spg

View 1spg on RCSB PDB site
Description: carbonmonoxy hemoglobin from the teleost fish leiostomus xanthurus
Class: oxygen transport
Keywords: carbon monoxide, r-state, leiostomus xanthurus, teleost fish, root effect, globin, oxygen transport
Deposited on 1996-02-05, released 1997-03-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Leiostomus xanthurus [TaxId:59837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1spga_
  • Chain 'B':
    Compound: hemoglobin
    Species: Leiostomus xanthurus [TaxId:59837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1spgb_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1spgA (A:)
    slsatdkarvkalwdkiegksaelgaealgrmlvsfpqtkiyfsewgqdlgpqtpqvrnh
    gavimaavgkavksidnlvgglsqlselhafklrvdpanfkilahniilvismyfpgdft
    pevhlsvdkflaclalalsekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1spgB (B:)
    vdwtdaeraaikalwgkidvgeigpqalsrllivypwtqrhfkgfgnistnaailgnakv
    aehgktvmggldravqnmdniknvykqlsikhsekihvdpdnfrllgeiitmcvgakfgp
    saftpeiheawqkflavvvsalgrqyh