PDB entry 1sp4

View 1sp4 on RCSB PDB site
Description: Crystal structure of NS-134 in complex with bovine cathepsin B: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Class: hydrolase/hydrolase inhibitor
Keywords: cathepsin B, epoxysuccinyl-based inhibitors, inhibitor design, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2004-03-16, released 2004-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cathepsin b
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07688 (0-47)
  Domains in SCOPe 2.06: d1sp4.1
• Chain 'B':
  Compound: cathepsin b
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07688 (0-204)
  Domains in SCOPe 2.06: d1sp4.1
• Heterogens: EP2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sp4A (A:)
  lpesfdareqwpncptikeirdqgscgscwafgaveaisdricihsng
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sp4B (B:)
  rvnvevsaedmltccggecgdgcnggfpsgawnfwtkkglvsgglynshvgcrpysippc
  ehhvngsrppctgegdtpkcnktcepgyspsykedkhfgcssysvannekeimaeiykng
  pvegafsvysdfllyksgvyqhvsgeimgghairilgwgvengtpywlvgnswntdwgdn
  gffkilrgqdhcgieseivagmpct