PDB entry 1sn1

View 1sn1 on RCSB PDB site
Description: structure of scorpion neurotoxin bmk m1
Class: toxin
Keywords: neurotoxin, sodium channel inhibitor, scorpion, toxin
Deposited on 1998-11-12, released 1999-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (neurotoxin bmk m1)
  Species: Mesobuthus martensii [TaxId:34649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45697 (0-63)
  Domains in SCOPe 2.08: d1sn1a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sn1A (A:)
  vrdayiakphncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpirvp
  gkch