PDB entry 1shb
View 1shb on RCSB PDB site
Description: crystal structure of the phosphotyrosine recognition domain sh2 of v-src complexed with tyrosine-phosphorylated peptides
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on
1992-08-18, released
1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: v-src sh2 domain
Species: Rous sarcoma virus [TaxId:11886]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1shba_ - Chain 'B':
Compound: phosphopeptide b
Species: Rous sarcoma virus [TaxId:11886]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1shbA (A:)
qaeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
Sequence, based on observed residues (ATOM records): (download)
>1shbA (A:)
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
- Chain 'B':
No sequence available.