PDB entry 1seg

View 1seg on RCSB PDB site
Description: Crystal structure of a toxin chimera between Lqh-alpha-IT from the scorpion Leiurus quinquestriatus hebraeus and AAH2 from Androctonus australis hector
Class: toxin
Keywords: toxin, chimera, scorpion
Deposited on 2004-02-17, released 2004-08-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.155
AEROSPACI score: -1.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aah2: lqh-alpha-it (face) chimeric toxin
    Species: Androctonus australis hector [TaxId:70175]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01484 (0-63)
      • engineered (7-9)
      • engineered (16)
      • engineered (55-58)
      • engineered (61)
    Domains in SCOPe 2.02: d1sega_
  • Heterogens: SO4, NO3, PPI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1segA (A:)
    vkdgyivknynctyfcfrnaycneectklkgesgycqwaspygnacycyklpdhvpirvp
    gkch