PDB entry 1s6n

View 1s6n on RCSB PDB site
Description: NMR Structure of Domain III of the West Nile Virus Envelope Protein, Strain 385-99
Class: Viral protein
Keywords: BETA BARREL, FLAVIVIRUS, Viral protein
Deposited on 2004-01-26, released 2004-07-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein
    Species: West Nile virus [TaxId:307044]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q913C7 (5-111)
      • see remark 999 (0-4)
      • see remark 999 (112-114)
    Domains in SCOPe 2.05: d1s6na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s6nA (A:)
isefqlkgttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltp
vgrlvtvnpfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgssigk