PDB entry 1s2z

View 1s2z on RCSB PDB site
Description: X-ray crystal structure of Desulfovibrio vulgaris Rubrerythrin with displacement of iron by zinc at the diiron Site
Class: electron transport
Keywords: Rubrerythrin, zinc-substituted, diiron four-helix bundle, rubredoxin-like, ELECTRON TRANSPORT
Deposited on 2004-01-12, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s2za1, d1s2za2
  • Heterogens: FE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2zA (A:)
    mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
    fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
    fasiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahp
    kahfellginw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2zA (A:)
    kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
    kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
    asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
    ahfellginw