PDB entry 1rxp

View 1rxp on RCSB PDB site
Description: structure of trypsin (orthorhombic) with 1-(4-tert-butylcarbamoyl- piperazine-1-carbonyl)-3-(3-guanidino-propyl)-4-oxo-azetidine-2-carboxylic acid
Class: hydrolase
Keywords: tryptase inhibitor; serine protease; azetidinone, hydrolase
Deposited on 2003-12-18, released 2004-06-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trypsin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-215)
  Domains in SCOPe 2.02: d1rxpa_
• Heterogens: CA, SO4, 169, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rxpA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn