PDB entry 1rx7

View 1rx7 on RCSB PDB site
Description: structure of dihydrofolate reductase complexed with folate
Class: oxidoreductase
Keywords: oxidoreductase, nadp, trimethoprim resistance, methotrexate resistance, one-carbon metabolism
Deposited on 1996-10-25, released 1997-03-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-158)
    • conflict (36)
  Domains in SCOPe 2.05: d1rx7a_
• Heterogens: FOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rx7A (A:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr