PDB entry 1rv7

View 1rv7 on RCSB PDB site
Description: Crystal structures of a Multidrug-Resistant HIV-1 Protease Reveal an Expanded Active Site Cavity
Class: hydrolase
Keywords: HIV protease, AIDS, polyprotein, hydrolase, aspartyl protease, multi-drug resistance, Lopinavir
Deposited on 2003-12-12, released 2004-12-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.271
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QM22 (0-98)
      • engineered (24)
      • engineered (35)
      • engineered (83)
    Domains in SCOPe 2.02: d1rv7a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QM22 (0-98)
      • engineered (24)
      • engineered (35)
      • engineered (83)
    Domains in SCOPe 2.02: d1rv7b_
  • Heterogens: AB1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv7A (A:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rv7B (B:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf