PDB entry 1rtp

View 1rtp on RCSB PDB site
Description: refined x-ray structure of rat parvalbumin, a mammalian alpha-lineage parvalbumin, at 2.0 a resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-05-14, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: alpha-parvalbumin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rtp1_
  • Chain '2':
    Compound: alpha-parvalbumin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rtp2_
  • Chain '3':
    Compound: alpha-parvalbumin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rtp3_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rtp1 (1:)
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rtp2 (2:)
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rtp3 (3:)
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes