PDB entry 1rpi

View 1rpi on RCSB PDB site
Description: Crystal structures of a Multidrug-Resistant HIV-1 Protease Reveal an Expanded Active Site Cavity
Class: hydrolase
Keywords: HIV protease, AIDS, polyprotein, hydrolase, aspartyl portease, multi-drug resistance
Deposited on 2003-12-03, released 2004-12-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.217
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1
  Database cross-references and differences (RAF-indexed):
  • GB AAF05674 (0-98)
    • engineered (24)
    • engineered (35)
    • engineered (83)
  Domains in SCOPe 2.02: d1rpia_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: HIV-1
  Database cross-references and differences (RAF-indexed):
  • GB AAF05674 (0-98)
    • engineered (24)
    • engineered (35)
    • engineered (83)
  Domains in SCOPe 2.02: d1rpib_
• Heterogens: GLC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rpiA (A:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rpiB (B:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf