PDB entry 1rly

View 1rly on RCSB PDB site
Description: RDC-derived models of the zinc ribbon domain of human general transcription TFIIB (zinc bound structures)
Class: metal binding protein
Keywords: Zinc ribbon, Rubredoxin knuckle, METAL BINDING PROTEIN
Deposited on 2003-11-26, released 2004-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription initiation factor iib
  Species: Homo sapiens [TaxId:9606]
  Gene: GTF2B, TFIIB, TF2B
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00403
  Domains in SCOPe 2.06: d1rlya_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1rlyA (A:)
  mastsrldalprvtcpnhpdailvedyragdmicpecglvvgdrvidvgsewrtfsndka
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1rlyA (A:)
  astsrldalprvtcpnhpdailvedyragdmicpecglvvgdrvidvgsewrtfsndk