PDB entry 1rfk

View 1rfk on RCSB PDB site
Description: Crystal Structure of 2Fe2S Ferredoxin from Thermophilic Cyanobacterium Mastigocladus Laminosus
Class: electron transport
Keywords: ferredoxin, thermostability, electron transport
Deposited on 2003-11-10, released 2005-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.2
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rfka_
  • Chain 'B':
    Compound: ferredoxin
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rfkb_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rfkA (A:)
    atykvtlineaeglnktievpddqyildaaeeagidlpyscragacstcagklisgtvdq
    sdqsfldddqieagyvltcvayptsdcviethkeeely
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfkA (A:)
    atykvtlinglnktievpddqyildaaeeagidlpyscragacstcagklisgtvdqsdq
    sfldddqieagyvltcvayptsdcviethkeeely
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rfkB (B:)
    atykvtlineaeglnktievpddqyildaaeeagidlpyscragacstcagklisgtvdq
    sdqsfldddqieagyvltcvayptsdcviethkeeely
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfkB (B:)
    atykvtlineaeglnktievpddqyildaaeeagidlpyscragacstcagklisgtvdq
    sdqsfldddqieagyvltcvayptsdcviethkeeel