PDB entry 1qwv

View 1qwv on RCSB PDB site
Description: Solution structure of Antheraea polyphemus pheromone binding protein (ApolPBP)
Class: transport protein
Keywords: pheromone binding protein, Antheraea polyphemus, PBP, ApolPBP, hexahelical fold, PBP fold, TRANSPORT PROTEIN
Deposited on 2003-09-03, released 2004-03-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone-binding protein
  Species: Antheraea polyphemus [TaxId:7120]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20797 (0-141)
  Domains in SCOPe 2.02: d1qwva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qwvA (A:)
  speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
  vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
  eihklnwvpnmdlvigevlaev