PDB entry 1qwf

View 1qwf on RCSB PDB site
Description: c-src sh3 domain complexed with ligand vsl12
Class: complex (signal transduction/peptide)
Keywords: src sh3 domain, class I ligand complex, complex (signal transduction/peptide) complex
Deposited on 1995-11-09, released 1996-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase transforming protein Src
    Species: Avian sarcoma virus [TaxId:11876]
    Gene: CHICKEN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qwfa_
  • Chain 'B':
    Compound: val-ser-leu-ala-arg-arg-pro-leu-pro-pro-leu-pro
    Database cross-references and differences (RAF-indexed):
    • PDB 1QWF (0-11)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1qwfA (A:)
gshmggvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsny
vaps

    Sequence, based on observed residues (ATOM records): (download) 
    >1qwfA (A:)
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

  • Chain 'B':
    No sequence available.