PDB entry 1qpu

View 1qpu on RCSB PDB site
Description: solution structure of oxidized escherichia coli cytochrome b562
Class: electron transport
Keywords: four helix bundle, hemoprotein, electron transport
Deposited on 1999-05-30, released 1999-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b562
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABE7 (0-105)
  Domains in SCOPe 2.08: d1qpua_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qpuA (A:)
  adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
  frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayhqkyr