PDB entry 1qli

View 1qli on RCSB PDB site
Description: quail cysteine and glycine-rich protein, nmr, minimized average structure
Class: metal-binding protein
Keywords: lim domain containing proteins, metal-binding protein
Deposited on 1997-02-17, released 1997-08-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteine and glycine-rich protein
    Species: Coturnix japonica [TaxId:93934]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qlia1, d1qlia2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1qliA (A:)
mdrgerlgikpesspsphrpttnpntskfaqkfggaekcsrcgdsvyaaekvigagkpwh
kncfrcakcgkslesttltekegeiyckgcyaknfgpkgfgygqgagalvhaq

    Sequence, based on observed residues (ATOM records): (download) 
    >1qliA (A:)
aekcsrcgdsvyaaekvigagkpwhkncfrcakcgkslesttltekegeiyckgcyakn