PDB entry 1qlc

View 1qlc on RCSB PDB site
Description: solution structure of the second pdz domain of postsynaptic density-95
Class: peptide recognition
Keywords: peptide recognition, pdz domain, neuronal nitric oxide synthase, nmda receptor binding
Deposited on 1999-08-25, released 2000-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: postsynaptic density protein 95
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31016 (0-94)
  Domains in SCOPe 2.05: d1qlca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qlcA (A:)
  aekvmeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgrlqigdkila
  vnsvgledvmhedavaalkntydvvylkvakpsna