PDB entry 1qji

View 1qji on RCSB PDB site
Description: Structure of astacin with a transition-state analogue inhibitor
Class: hydrolase(metalloproteinase)
Keywords: hydrolase(metalloproteinase), astacins, metzincins
Deposited on 1999-06-24, released 2000-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: astacin
    Species: ASTACUS FLUVIATILIS [TaxId:6715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qjia_
  • Heterogens: ZN, PKF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qjiA (A:)
aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
hmlqtdanqinnlytnecsl