PDB entry 1qib

View 1qib on RCSB PDB site
Description: crystal structure of gelatinase a catalytic domain
Class: hydrolase
Keywords: inhibitor, matrixin, matrix metalloproteinase-2 (mmp-2), gelatinase a, metzincin, hydrolase
Deposited on 1999-06-11, released 1999-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (gelatinase a)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08253 (105-160)
    • engineered (99)
    • engineered (102)
  Domains in SCOPe 2.06: d1qiba_
• Heterogens: ZN, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qibA (A:)
  rkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgeadiminfg
  rwehgdgypfdgkdgllahafapgtgvggdshfdddelwslgkgvgyslflvaahefgha
  mglehsqdpgalmapiytytknfrlsqddikgiqelygasp