PDB entry 1qac
View 1qac on RCSB PDB site
Description: change in dimerization mode by removal of a single unsatisfied polar residue
Class: immune system
Keywords: beta barrel immunoglobulin vl domain dimer, flipped domain dimer, immune system
Deposited on
1999-02-25, released
2000-02-23
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: immunoglobulin light chain variable domain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1qaca_ - Chain 'B':
Compound: immunoglobulin light chain variable domain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1qacb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1qacA (A:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyyclqyystpysfgqgtkleikr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1qacB (B:)
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyyclqyystpysfgqgtkleikr