SCOPe 2.05: Structural Classification of Proteins

PDB entry 1q5r

View 1q5r on RCSB PDB site
Description: The Rhodococcus 20S proteasome with unprocessed pro-peptides
Class: hydrolase
Keywords: proteasome assembly, pro-peptide, inter-subunit contacts, Rhodococcus erythropolis, HYDROLASE
Deposited on 2003-08-08, released 2003-12-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.229
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: proteasome alpha-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCA(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53080
Domains in SCOPe 2.05: d1q5ra_
Chain 'B':
Compound: proteasome alpha-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCA(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53080
Domains in SCOPe 2.05: d1q5rb_
Chain 'C':
Compound: proteasome alpha-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCA(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53080
Domains in SCOPe 2.05: d1q5rc_
Chain 'D':
Compound: proteasome alpha-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCA(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53080
Domains in SCOPe 2.05: d1q5rd_
Chain 'E':
Compound: proteasome alpha-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCA(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53080
Domains in SCOPe 2.05: d1q5re_
Chain 'F':
Compound: proteasome alpha-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCA(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53080
Domains in SCOPe 2.05: d1q5rf_
Chain 'G':
Compound: proteasome alpha-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCA(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53080
Domains in SCOPe 2.05: d1q5rg_
Chain 'H':
Compound: proteasome beta-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCB(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53079
Domains in SCOPe 2.05: d1q5rh_
Chain 'I':
Compound: proteasome beta-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCB(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53079
Domains in SCOPe 2.05: d1q5ri_
Chain 'J':
Compound: proteasome beta-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCB(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53079
Domains in SCOPe 2.05: d1q5rj_
Chain 'K':
Compound: proteasome beta-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCB(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53079
Domains in SCOPe 2.05: d1q5rk_
Chain 'L':
Compound: proteasome beta-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCB(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53079
Domains in SCOPe 2.05: d1q5rl_
Chain 'M':
Compound: proteasome beta-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCB(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53079
Domains in SCOPe 2.05: d1q5rm_
Chain 'N':
Compound: proteasome beta-type subunit 1
Species: Rhodococcus erythropolis [TaxId:1833]
Gene: PRCB(1)
Database cross-references and differences (RAF-indexed):
- Uniprot Q53079
Domains in SCOPe 2.05: d1q5rn_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1q5rA (A:)
mhhhhhhsaeqimrdrselarkgiargrsvvvltfrdgvlfvaenpstalhkvselydrl
gfaavgkynefenlrragivhadmrgysydrrdvtgrslanayaqtlgtifteqpkpyev
eicvaevgrvgspkapqlyritydgsivdeqhfvvmggttepiatamresyradldleaa
vgiavnalrqggagegekrnvdvaslevavldqsrprrafrriagtaleqlvpaepaaas
esapepkpdtetkpadtqd