PDB entry 1q56

View 1q56 on RCSB PDB site
Description: NMR structure of the B0 isoform of the agrin G3 domain in its Ca2+ bound state
Class: metal binding protein
Keywords: NMJ synapse, mRNA splicing, AChR aggregation, laminin-G like domain, conformational flexibility, MuSK activation, Ca2+ regulation, METAL BINDING PROTEIN
Deposited on 2003-08-06, released 2004-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Agrin
  Species: Gallus gallus [TaxId:9031]
  Gene: AGRN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31696 (0-194)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1q56a1, d1q56a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1q56A (A:)
  gsekviiekaagdaeaiafdgrtymeyhnavtksekalqsnhfelsikteatqglilwsg
  kglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgn
  eapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlv
  edalnnptilhcsak