PDB entry 1q1o

View 1q1o on RCSB PDB site
Description: Solution Structure of the PB1 Domain of Cdc24p (Long Form)
Class: signaling protein
Keywords: PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction, SIGNALING PROTEIN
Deposited on 2003-07-22, released 2003-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 24
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Cdc24p
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11433 (4-97)
      • cloning artifact (0-3)
    Domains in SCOPe 2.05: d1q1oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q1oA (A:)
    gplgsilfrisynnnsnntssseiftllvekvwnfddlimainskisnthnnnispitki
    kyqdedgdfvvlgsdedwnvakemlaennekflnirly