PDB entry 1pqs

View 1pqs on RCSB PDB site
Description: Solution structure of the C-terminal OPCA domain of yCdc24p
Class: cell cycle
Keywords: Alpha and Beta protein, CELL CYCLE
Deposited on 2003-06-19, released 2003-07-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 24
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Cdc24p
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1pqsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pqsA (A:)
seiftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedwnva
kemlaennekflnirly