PDB entry 1p2k
View 1p2k on RCSB PDB site
Description: Structural consequences of accommodation of four non-cognate amino-acid residues in the S1 pocket of bovine trypsin and chymotrypsin
Class: hydrolase/hydrolase inhibitor
Keywords: trypsin; chymotrypsin; serine proteinase; bovine pancreatic trypsin inhibitor; protein-protein interaction; non-cognate binding; S1 pocket; primary specificity; crystal structure, hydrolase/hydrolase inhibitor COMPLEX
Deposited on
2003-04-15, released
2004-04-20
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.58
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: trypsinogen, cationic
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1p2ka_ - Chain 'I':
Compound: pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P00974 (0-57)
- engineered (14)
- engineered (51)
Domains in SCOPe 2.02: d1p2ki_ - Heterogens: CA, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1p2kA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>1p2kI (I:)
rpdfcleppytgpcvariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga