PDB entry 1op2

View 1op2 on RCSB PDB site
Description: Crystal Structure of AaV-SP-II, a Glycosylated Snake Venom Serine Proteinase from Agkistrodon acutus
Class: hydrolase
Keywords: snake venom, serine proteinase, glycoprotein, Agkistrodon acutus, hydrolase
Deposited on 2003-03-04, released 2004-05-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.165
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Venom serine proteinase
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1op2a_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1op2A (A:)
    viggnecdinehrflvaffnttgffcggtlinpewvvtaahcdstnfqmqlgvhskkvln
    edeqtrnpkekficpnknnnevldkdimlikldkpisnskhiaplslpssppsvgsvcri
    mgwgsitpvketfpdvpycaninlldhavcqagypellaeyrtlcagivqggkdtcggds
    ggplicngqfqgivsygahpcgqgpkpgiytnvfdytdwiqrniagntdatcpp