PDB entry 1oot

View 1oot on RCSB PDB site
Description: Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution
Class: structural genomics
Keywords: sh3 domain, sturctural genomics, structural genomics
Deposited on 2003-03-04, released 2004-04-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.134
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFR024C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1oota_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ootA (A:)
gsspkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv

    Sequence, based on observed residues (ATOM records): (download) 
    >1ootA (A:)
spkavalysfageesgdlpfrkgdvitilkksdsqndwwtgrvngregifpanyvelv