PDB entry 1omr

View 1omr on RCSB PDB site
Description: non-myristoylated wild-type bovine recoverin with calcium bound to EF-hand 3
Class: metal binding protein
Keywords: EF-hand, helix-loop-helix, metal binding protein
Deposited on 2003-02-26, released 2003-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.249
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recoverin
    Species: Bos taurus [TaxId:9913]
    Gene: RCV1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1omra_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1omrA (A:)
gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
ilrliqfepqkvkeklkekkl