SCOPe 2.08: Structural Classification of Proteins

PDB entry 1ojx

View 1ojx on RCSB PDB site
Description: Crystal structure of an Archaeal fructose 1,6-bisphosphate aldolase
Class: lyase
Keywords: lyase, aldolase, fructose 1, 6-bisphosphate, tim barrel, glycolytic, archaeal
Deposited on 2003-07-16, released 2003-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxa_
Chain 'B':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxb_
Chain 'C':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxc_
Chain 'D':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxd_
Chain 'E':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxe_
Chain 'F':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxf_
Chain 'G':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxg_
Chain 'H':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxh_
Chain 'I':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxi_
Chain 'J':
Compound: fructose-bisphosphate aldolase class I
Species: Thermoproteus tenax [TaxId:2271]
Database cross-references and differences (RAF-indexed):
- Uniprot P58315
Domains in SCOPe 2.08: d1ojxj_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1ojxA (A:)
manltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvf
qrgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfe
wkmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkiky
tgdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrda
lkfaralaelvyggkklaeplnv