PDB entry 1nx3

View 1nx3 on RCSB PDB site
Description: Calpain Domain VI in Complex with the Inhibitor PD150606
Class: hydrolase
Keywords: hydrolase, calcium binding
Deposited on 2003-02-07, released 2003-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.21
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-dependent protease, small subunit
    Species: Sus scrofa [TaxId:9823]
    Gene: CAPNS1 OR CAPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nx3a_
  • Heterogens: CA, ISA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nx3A (A:)
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys