PDB entry 1npi

View 1npi on RCSB PDB site
Description: Tityus Serrulatus Neurotoxin (Ts1) at atomic resolution
Class: toxin
Keywords: xcitatory neurotoxin, toxin
Deposited on 2003-01-17, released 2003-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: 0.103
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Toxin VII
  Species: Tityus serrulatus [TaxId:6887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15226 (0-60)
  Domains in SCOPe 2.08: d1npia_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1npiA (A:)
  kegylmdhegcklscfirpsgycgrecgikkgssgycawpacycyglpnwvkvwdratnk
  c