PDB entry 1neq

View 1neq on RCSB PDB site
Description: solution structure of the mu ner protein by multidimensional nmr
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1995-08-24, released 1995-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding protein ner
  Species: Enterobacteria phage Mu [TaxId:10677]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06020 (0-73)
  Domains in SCOPe 2.08: d1neqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1neqA (A:)
  csnekardwhradviaglkkrklslsalsrqfgyapttlanalerhwpkgeqiianalet
  kpeviwpsryqage