PDB entry 1nd1

View 1nd1 on RCSB PDB site
Description: Amino acid sequence and crystal structure of BaP1, a metalloproteinase from Bothrops asper snake venom that exerts multiple tissue-damaging activities.
Class: toxin
Keywords: metalloproteinase, snake venom, three-disulfide, TOXIN
Deposited on 2002-12-06, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: BaP1
  Species: Bothrops asper [TaxId:8722]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83512 (0-201)
  Domains in SCOPe 2.08: d1nd1a_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nd1A (A:)
  erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
  kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
  hsvgvvrdhsknnlwvavtmahelghnlgidhdtgscscgakscimasvlskvlsyefsd
  csqnqyetyltnhnpqcilnkp