PDB entry 1mut

View 1mut on RCSB PDB site
Description: nmr study of mutt enzyme, a nucleoside triphosphate pyrophosphohydrolase
Class: DNA repair
Keywords: DNA repair
Deposited on 1995-09-14, released 1996-04-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nucleoside triphosphate pyrophosphohydrolase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08337 (0-128)
  Domains in SCOPe 2.01: d1muta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mutA (A:)
  mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
  tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
  pviaklkrl