PDB entry 1mph

View 1mph on RCSB PDB site
Description: pleckstrin homology domain from mouse beta-spectrin, nmr, 50 structures
Class: signal transduction
Keywords: signal transduction, inositol phosphates
Deposited on 1997-04-23, released 1997-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta spectrin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62261 (0-105)
  Domains in SCOPe 2.06: d1mpha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mphA (A:)
  megflnrkheweahnkkassrswhnvycvinnqemgfykdaksaasgipyhsevpvslke
  aicevaldykkkkhvfklrlsdgneylfqakddeemntwiqaissa