PDB entry 1mkc

View 1mkc on RCSB PDB site
Description: c-terminal domain of midkine
Class: heparin-binding growth factor
Keywords: heparin-binding growth factor
Deposited on 1999-03-16, released 1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (midkine)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mkca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mkcA (A:)
    ckykfenwgacdggtgtkvrqgtlkkarynaqcqetirvtkpc