PDB entry 1mhx

View 1mhx on RCSB PDB site
Description: Crystal Structures of the redesigned protein G variant NuG1
Class: immune system
Keywords: alpha-beta protein, redesigned first beta-hairpin, IMMUNE SYSTEM
Deposited on 2002-08-21, released 2002-09-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin-binding protein G
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed):
    • PIR A45063 (8-64)
      • expression tag (0-7)
      • see remark 999 (14-24)
      • engineered (57)
    Domains in SCOPe 2.02: d1mhxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhxA (A:)
    mhhhhhhamdtyklfivigdrvvvvtteavdaataekvfkqyandngvdgewtyddaakt
    ftvte