PDB entry 1mfg

View 1mfg on RCSB PDB site
Description: The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
Class: signaling protein
Keywords: pdz domain, protein-peptide complex, erb-b2, erbin., signaling protein
Deposited on 2002-08-10, released 2003-01-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.128
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Erb-B2 INTERACTING PROTEIN
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RT1 (0-94)
      • cloning artifact (0-2)
    Domains in SCOPe 2.01: d1mfga_
  • Chain 'B':
    Compound: Erb-B2 carboxyl-terminal fragment
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1MFG (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mfgA (A:)
gsmeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgdkiiq
angysfiniehgqavsllktfqntveliivrevss

  • Chain 'B':
    No sequence available.