PDB entry 1mc7

View 1mc7 on RCSB PDB site
Description: Solution Structure of mDvl1 PDZ domain
Class: Signaling protein
Keywords: PDZ Domain, Wnt Signaling, Signaling protein
Deposited on 2002-08-05, released 2003-09-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Segment polarity protein dishevelled homolog DVL-1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51141 (0-94)
    • engineered (87)
  Domains in SCOPe 2.01: d1mc7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mc7A (A:)
  tvtlnmerhhflgisivgqsndrgdggiyigsimkggavaadgriepgdmllqvndvnfe
  nmsnddavrvlreivsqtgpisltvakawdptprs