PDB entry 1lxg

View 1lxg on RCSB PDB site
Description: Solution structure of alpha-cobratoxin complexed with a cognate peptide (structure ensemble)
Class: toxin
Keywords: toxin, alpha-cobratoxin, nicotinic acetylcholine receptor, protein-protein interaction
Deposited on 2002-06-05, released 2002-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: long neurotoxin 1
    Species: Naja kaouthia [TaxId:8649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lxga_
  • Chain 'B':
    Compound: acetylcholine receptor protein, alpha chain
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lxgA (A:)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp
    

  • Chain 'B':
    No sequence available.