PDB entry 1lsp

View 1lsp on RCSB PDB site
Description: the crystal structure of a bulgecin-inhibited g-type lysozyme from the egg-white of the australian black swan. a comparison of the binding of bulgecin to three muramidases
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-02-09, released 1996-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-19, with a file datestamp of 2014-03-14.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.175
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Cygnus atratus [TaxId:8868]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lspa_
  • Heterogens: BUL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lspA (A:)
    rtdcygnvnridttgascktakpeglsycgvpasktiaerdlkamdryktiikkvgeklc
    vepaviagiisreshagkvlkngwgdrgngfglmqvdkrshkpqgtwngevhitqgttil
    tdfikriqkkfpswtkdqqlkggisaynagagnvrsyarmdigtthddyandvvaraqyy
    kqhgy