PDB entry 1lmz

View 1lmz on RCSB PDB site
Description: Solution Structure of 3-Methyladenine DNA Glycosylase I (TAG)
Class: hydrolase
Keywords: helix-hairpin-helix superfamily, DNA glycosylase, enzyme, TAG, 3-methyladenine, solution structure, NMR spectroscopy, HYDROLASE
Deposited on 2002-05-02, released 2002-08-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-Methyladenine Dna Glycosylase I (TAG)
    Species: Escherichia coli [TaxId:37762]
    Gene: TAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1lmza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lmzA (A:)
mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
cypgnkp