PDB entry 1le8
View 1le8 on RCSB PDB site
Description: Crystal Structure of the MATa1/MATalpha2-3A Heterodimer Bound to DNA Complex
Class: transcription/DNA
Keywords: MATalpha2, isothermal titration calorimetry, protein-DNA complex, TRANSCRIPTION/DNA COMPLEX
Deposited on
2002-04-09, released
2002-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.256
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: mating-type protein a-1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1le8a_ - Chain 'B':
Compound: Mating-type protein alpha-2
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: MATalpha2
Database cross-references and differences (RAF-indexed):
- Uniprot Q6B184
- engineered (53-54)
- engineered (57)
Domains in SCOPe 2.08: d1le8b_ - Chain 'C':
Compound: 5'-d(*ap*cp*ap*tp*gp*tp*ap*ap*ap*ap*ap*tp*tp*tp*ap*cp*ap*tp*cp*a)-3'
- Chain 'D':
Compound: 5'-d(*tp*tp*gp*ap*tp*gp*tp*ap*ap*ap*tp*tp*tp*tp*tp*ap*cp*ap*tp*g)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1le8A (A:)
kssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrsk
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1le8B (B:)
tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvaarrake
ktitiapeladllsgeplakkke
Sequence, based on observed residues (ATOM records): (download)
>1le8B (B:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvaarrakektit
iapeladllsgepl
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.