PDB entry 1le8

View 1le8 on RCSB PDB site
Description: Crystal Structure of the MATa1/MATalpha2-3A Heterodimer Bound to DNA Complex
Class: transcription/DNA
Keywords: MATalpha2, isothermal titration calorimetry, protein-DNA complex, TRANSCRIPTION/DNA COMPLEX
Deposited on 2002-04-09, released 2002-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.256
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mating-type protein a-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1le8a_
  • Chain 'B':
    Compound: Mating-type protein alpha-2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MATalpha2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6B184
      • engineered (53-54)
      • engineered (57)
    Domains in SCOPe 2.08: d1le8b_
  • Chain 'C':
    Compound: 5'-d(*ap*cp*ap*tp*gp*tp*ap*ap*ap*ap*ap*tp*tp*tp*ap*cp*ap*tp*cp*a)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*tp*gp*ap*tp*gp*tp*ap*ap*ap*tp*tp*tp*tp*tp*ap*cp*ap*tp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1le8A (A:)
    kssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1le8B (B:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvaarrake
    ktitiapeladllsgeplakkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1le8B (B:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvaarrakektit
    iapeladllsgepl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.