PDB entry 1kzk
View 1kzk on RCSB PDB site
Description: JE-2147-HIV Protease Complex
Class: hydrolase/hydrolase inhibitor
Keywords: HIV Protease Complex, Anisotropic Displacement Parameters, Viral protein, hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2002-02-06, released
2002-04-03
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.152
AEROSPACI score: 0.92
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus [TaxId:12721]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1kzka_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus [TaxId:12721]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1kzkb_ - Heterogens: JE2, CL, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1kzkA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1kzkB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf