PDB entry 1kzk

View 1kzk on RCSB PDB site
Description: JE-2147-HIV Protease Complex
Class: hydrolase/hydrolase inhibitor
Keywords: HIV Protease Complex, Anisotropic Displacement Parameters, Viral protein, hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2002-02-06, released 2002-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.152
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus [TaxId:12721]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOPe 2.07: d1kzka_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus [TaxId:12721]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (6)
    Domains in SCOPe 2.07: d1kzkb_
  • Heterogens: JE2, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kzkA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kzkB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf